PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01392g03014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 335aa    MW: 37624.2 Da    PI: 9.0692
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01392g03014.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.22.1e-39105165262
                    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                               ke+a++cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+s+
  Niben101Scf01392g03014.1 105 KEQAINCPRCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSN 165
                               7899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-27102157IPR003851Zinc finger, Dof-type
PfamPF027011.4E-33107163IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.106109163IPR003851Zinc finger, Dof-type
PROSITE patternPS013610111147IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MKFQNMLFLV ANRYMEPPKR PSQVKWHFPC FRTRASCKVR CFHHLLCDSL PSFPPFAFSS  60
PLLSAPPYPF FNMDTSHWPQ GIGLVKAVEP SKPVPATERK PRPQKEQAIN CPRCNSTNTK  120
FCYYNNYSLS QPRYFCKTCR RYWTEGGSLR NVPVGGGSRK NKRSNSSNNS SSSTSSYKKI  180
PDITIPTSSQ NPKIINEPHD LNLTFNPSTT SNFSNISEFM TLPLMNPNST TSFMSSIMPQ  240
LSDSNNIMYS SSSTRLPNLH DLKPTLNFSL DGFDNDNGYG SLQGETAGAK LFFPLDDLKN  300
VSTANDDHEF DEQNRGQAAE SHGFWNGMLG GGSSW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009801284.11e-170PREDICTED: dof zinc finger protein DOF1.8-like
RefseqXP_016497460.11e-170PREDICTED: dof zinc finger protein DOF1.8-like
TrEMBLA0A068PXR91e-170A0A068PXR9_TOBAC; Dof zinc finger protein
STRINGSolyc03g082840.2.11e-89(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64620.13e-39Dof family protein